General Information

  • ID:  hor004068
  • Uniprot ID:  Q9NIP6
  • Protein name:  CAP-2
  • Gene name:  Capa
  • Organism:  Drosophila melanogaster (Fruit fly)
  • Family:  Pyrokinin family
  • Source:  animal
  • Expression:  In larvae, the precursor peptide is exclusively present in a single pair of neuroendocrine cells in the labial neuromere (subesophageal ganglion) and three pairs of cells in the ventral ganglion abdominal neuromeres.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  melanogaster subgroup, melanogaster group, Sophophora (subgenus), Drosophila (genus), Drosophilini (tribe), Drosophilinae (subfamily), Drosophilidae (family), Ephydroidea (superfamily), Acalyptratae, Schizophora, Cyclorrhapha, Eremoneura, Muscomorpha (infraorder), Brachycera (suborder), Diptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005184 neuropeptide hormone activity; GO:0008613 diuretic hormone activity; GO:0016084 myostimulatory hormone activity; GO:0071855 neuropeptide receptor binding
  • GO BP:  GO:0006812 monoatomic cation transport; GO:0007204 positive regulation of cytosolic calcium ion concentration; GO:0007218 neuropeptide signaling pathway; GO:0038060 nitric oxide-cGMP-mediated signaling pathway; GO:0042045 epithelial fluid transport
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  ASGLVAFPRV
  • Length:  10
  • Propeptide:  MKSMLVHIVLVIFIIAEFSTAETDHDKNRRGANMGLYAFPRVGRSDPSLANSLRDGLEAGVLDGIYGDASQEDYNEADFQKKASGLVAFPRVGRGDAELRKWAHLLALQQVLDKRTGPSASSGLWFGPRLGKRSVDAKSFADISKGQKELN
  • Signal peptide:  MKSMLVHIVLVIFIIAEFSTA
  • Modification:  T10 Valine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Leads to Malpighian tubule fluid secretion via the second messenger nitric oxide
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q9NIP6-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor004068_AF2.pdbhor004068_ESM.pdb

Physical Information

Mass: 117692 Formula: C47H77N13O12
Absent amino acids: CDEHIKMNQTWY Common amino acids: AV
pI: 10.55 Basic residues: 1
Polar residues: 2 Hydrophobic residues: 6
Hydrophobicity: 113 Boman Index: 222
Half-Life: 4.4 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 117
Instability Index: 2072 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  12171930
  • Title:  Peptidomics of the Larval Drosophila Melanogaster Central Nervous System.
  • PubMed ID:  11959669
  • Title:  Two Nitridergic Peptides Are Encoded by the Gene Capability in Drosophila Melanogaster